Productivity: productive, stop_codon, vj_in_frame#
Three AIRR columns say whether a rearrangement could make a receptor. They are the most misread columns arda writes, because each one is scoped differently and none of them means “the junction looks like germline”. This page states the rule arda applies and then works through real reads where the rule is the only thing that settles the answer.
The rule#
column |
what arda puts in it |
|---|---|
|
|
|
|
|
|
all three |
Empty when the read never reached both the junction and FR4. That is not
“non-productive”, it is unevaluable — on real bulk RNA-seq it is about 72 % of mapped
reads, and writing |
vj_in_frame is a statement about where the frame lands at FR4, which is what decides
whether the constant region translates. It is not a statement about the junction’s length, and
it is not a statement about whether the junction’s 3′ residues match the called J’s germline
residues. Those are different questions and they give different answers — see
The two tests that disagree.
Flags, never filters#
arda writes these columns and does not act on them. No stage drops a non-productive read, and no threshold is applied anywhere. A non-functional rearrangement is real biology: one allele of a T cell’s two is usually out of frame, and a sample with no out-of-frame reads is usually a sample that has been filtered upstream.
Worked examples#
Every sequence below is a GenBank cDNA entry annotated by arda annotate. They are shown
translated from Cys104 in the frame arda used.
An ordinary productive read#
MH918759.1 — human TRA, TRAJ31*01. The entry runs 66 nt past FR4, so the constant
region is in the read itself and needs no reconstruction:
CVVNIRGNARLMF GDGTQLVVKP NIQNPDPAVYQLRDSKSSDKSV
└─ junction ─┘└── FR4 ──┘└──────── TRAC ────────┘
vj_in_frame=T stop_codon=F productive=T
The frame runs from the V through the junction, through the canonical FR4 FGDGTQLVVKP, and
on into TRAC without a stop. That is vj_in_frame=T by definition.
An indel inside the J#
JX277388.1 — mouse TRB, TRBJ2-5*01. This read is the instructive one, because a
germline-frame test and a functional test give opposite answers.
germline TRBJ2-5*01 AACCAAGACACCCAGTACTTT··GGGCCAGGCACTCGGCTCCTCGTGTTAG
in its own frame N Q D T Q Y F G P G T R L L V L
the read ..CCAAGACACCCAGTACTTTTTGGGCCAGGCACTCGGCTCCTC..
^^
two nucleotides germline does not have
The read carries two nucleotides between the anchor codon and FR4 that TRBJ2-5*01 does not
have. So the J’s 5′ germline residues and its own FR4 cannot both be read in the germline
frame — whichever one you put in frame, the other is shifted.
arda’s frame puts FR4 in frame:
CTCSAGGPRHPVLF GPGTR
└─ junction ──┘└ FR4 ┘ FR4 matches germline GPGTR exactly
vj_in_frame=T stop_codon=F productive=T
Splice TRBC2*01 onto it and translate: 0 stop codons over 375 nt, yielding the real
mouse TRBC2 protein.
CTCSAGGPRHPVLFGPGTRLLVL EDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSG...
└──────────────────── TRBC2 ────────────────────────────
The receptor translates. vj_in_frame=T is correct. A tool that reads the J’s frame from a
lookup table keyed on the J’s 5′ alignment start reports F for this read, because on that
side of the extra two nucleotides the germline residues are indeed shifted.
JX277345.1 — mouse TRB, TRBJ1-3*01 — is the same shape with one extra nucleotide
instead of two:
CASSLLRQGEVEIRSIF GEGSR FR4 matches germline GEGSR exactly
+ TRBC2*01 -> CASSLLRQGEVEIRSIFGEGSRLIVVEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARG...
0 stop codons. vj_in_frame=T stop_codon=F productive=T
A truncated J answers nothing#
X60894.1 — mouse TRA, TRAJ9*01. The entry is 45 nt and stops three nucleotides into
FR4:
germline TRAJ9*01 AGGAACATGGGCTACAAACTTACCTTCGGGACAGGAACAAGC...
the read ..GAACATGGGCTACAAACTTAC·TTCGGG <- read ends here
^ one nucleotide deleted
arda: CALSDGEHGLQTYF G
└ the only FR4 residue the read carries
The single FR4 codon present (GGG) is germline FR4’s own first codon and sits on arda’s
codon boundary, and completing the J from germline then splicing TRAC*01 gives 0 stops over
261 nt. But one residue of FR4 is not evidence. With the J truncated this far, no tool can
answer the question from this read alone; treat the call as provisional rather than as a
disagreement between annotators.
The two tests that disagree#
There are two natural ways to ask “is the J in frame”, and they are not the same test:
test |
what it actually measures |
|---|---|
Does FR4 land on a codon boundary? |
Whether the constant exon translates. This is what |
Do the junction’s 3′ residues match the called J’s germline residues? |
Whether the read’s J end resembles germline. This is not a frame test. |
The second test is tempting because it needs nothing but the junction string, and it is wrong
often enough to be dangerous. Measured across arda’s fixtures it fires on 51.8 % of IGL,
51.4 % of IGK and 39.8 % of IGH rows (mean v_identity .955–.968) against 3.4 % of TRB
and 7.1 % of TRA (mean v_identity .992). The gradient follows hypermutation, not frame:
it is detecting SHM that has reached the J, which is biology, not a defect. Do not use it as a
productivity check.
How often does this matter#
Over 3,601 fixture rows where arda and IgBLAST both produced an evaluable call and agreed on
junction_aa, the two tools disagree on vj_in_frame for 8 rows (0.22 %). Every one
was examined read by read; each is a read carrying an indel inside the J, or a J truncated too
far to call. The column is stable — but when it does disagree, the disagreement is about which
of the two tests above is being run.
Checking a call yourself#
The self-contained check, for any read where the answer matters:
import polars as pl
df = pl.read_csv("sample.airr.tsv", separator="\t", quote_char=None)
row = df.filter(pl.col("sequence_id") == "MH918759.1").row(0, named=True)
# arda's frame runs from Cys104; the junction and FR4 are contiguous in it
print(row["junction_aa"], row["fwr4_aa"], row["vj_in_frame"], row["productive"])
If FR4 reproduces the called J allele’s germline FR4 residues, the frame is the germline J’s
own frame, and the constant exon spliced to that J is in frame too. That is the whole of
vj_in_frame.
See also
Somatic hypermutation for v_mutations / v_identity, which is what the second test above is
really measuring, and Quality control for the per-sample counts of out-of-frame and stop-codon
reads.